MTHFS antibody
-
- Target See all MTHFS Antibodies
- MTHFS (5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MTHFS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY
- Top Product
- Discover our top product MTHFS Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MTHFS Blocking Peptide, catalog no. 33R-9307, is also available for use as a blocking control in assays to test for specificity of this MTHFS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTHFS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTHFS (5,10-Methenyltetrahydrofolate Synthetase (5-Formyltetrahydrofolate Cyclo-Ligase) (MTHFS))
- Alternative Name
- MTHFS (MTHFS Products)
- Synonyms
- MTHFS antibody, 1110034I12Rik antibody, 2310020H23Rik antibody, AI119695 antibody, HsT19268 antibody, 5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase) antibody, methenyltetrahydrofolate synthetase antibody, 5-formyltetrahydrofolate cyclo-ligase (predicted) antibody, 5-formyltetrahydrofolate cyclo-ligase antibody, 5, 10-methenyltetrahydrofolate synthetase antibody, MTHFS antibody, SPBC1703.08c antibody, ZMO0215 antibody, LBA1507 antibody, Rxyl_1321 antibody, MEMAR_RS07640 antibody, Mjls_4669 antibody, STROP_RS03755 antibody, Mext_0779 antibody, AMF_RS07350 antibody, CKC_02040 antibody, Mthfs antibody
- Background
- MTHFS contributes to tetrahydrofolate metabolism. It helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids.
- Molecular Weight
- 23 kDa (MW of target protein)
-