DUSP19 antibody (C-Term)

Catalog No. ABIN632710

This Rabbit Polyclonal antibody specifically detects DUSP19 in WB. It exhibits reactivity toward Human.

Quick Overview for DUSP19 antibody (C-Term) (ABIN632710)

Target: DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DUSP19 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DUSP19 Antibody

Binding Specificity: C-Term

Specificity: DUSP19 antibody was raised against the C terminal of DUSP19

Purification: Affinity purified

Immunogen: DUSP19 antibody was raised using the C terminal of DUSP19 corresponding to a region with amino acids SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DUSP19 Blocking Peptide, (ABIN5613270), is also available for use as a blocking control in assays to test for specificity of this DUSP19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DUSP19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DUSP19

Target: DUSP19 (Dual Specificity Phosphatase 19 (DUSP19))

Alternative Name: DUSP19

Background: DUSP19 belongs to the protein-tyrosine phosphatase family, non-receptor class dual specificity subfamily. It contains 1 tyrosine-protein phosphatase domain. DUSP19 has a dual specificity toward Ser/Thr and Tyr-containing proteins.

Molecular Weight: 24 kDa (MW of target protein)