JOSD2 antibody (N-Term)

Catalog No. ABIN632715

The Rabbit Polyclonal anti-JOSD2 antibody (ABIN632715) specifically detects JOSD2 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for JOSD2 antibody (N-Term) (ABIN632715)

Target: JOSD2 (Josephin Domain Containing 2 (JOSD2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This JOSD2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-JOSD2 Antibody

Binding Specificity: N-Term

Specificity: JOSD2 antibody was raised against the N terminal of JOSD2

Purification: Affinity purified

Immunogen: JOSD2 antibody was raised using the N terminal of JOSD2 corresponding to a region with amino acids QQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

JOSD2 Blocking Peptide, (ABIN5614246), is also available for use as a blocking control in assays to test for specificity of this JOSD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JOSD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for JOSD2

Target: JOSD2 (Josephin Domain Containing 2 (JOSD2))

Alternative Name: JOSD2

Background: The specific function of JOSD2 is not yet known.

Molecular Weight: 21 kDa (MW of target protein)