FAM83F antibody (Middle Region)

Catalog No. ABIN632716

This Rabbit Polyclonal antibody specifically detects FAM83F in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for FAM83F antibody (Middle Region) (ABIN632716)

Target: FAM83F (Family with Sequence Similarity 83, Member F (FAM83F))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM83F antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM83F Antibody

Binding Specificity: Middle Region

Specificity: FAM83 F antibody was raised against the middle region of FAM83

Purification: Affinity purified

Immunogen: FAM83 F antibody was raised using the middle region of FAM83 corresponding to a region with amino acids FRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM83F Blocking Peptide, (ABIN938429), is also available for use as a blocking control in assays to test for specificity of this FAM83F antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM83F

Target: FAM83F (Family with Sequence Similarity 83, Member F (FAM83F))

Alternative Name: FAM83F

Background: The function of FAM83F protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 55 kDa (MW of target protein)