PACRGL antibody (Middle Region)

Catalog No. ABIN632727

This anti-PACRGL antibody is a Rabbit Polyclonal antibody detecting PACRGL in WB. Suitable for Human, Mouse and Rat.

Quick Overview for PACRGL antibody (Middle Region) (ABIN632727)

Target: PACRGL (PARK2 Co-Regulated-Like (PACRGL))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PACRGL antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PACRGL Antibody

Binding Specificity: Middle Region

Specificity: C4 ORF28 antibody was raised against the middle region of C4 rf28

Purification: Affinity purified

Immunogen: C4 ORF28 antibody was raised using the middle region of C4 rf28 corresponding to a region with amino acids PPESLSFDPLLITLAEGLRETKHPYTFVSKEGFRELLLVKGAPEKAIPLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C4ORF28 Blocking Peptide, (ABIN5612521), is also available for use as a blocking control in assays to test for specificity of this C4ORF28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PACRGL

Target: PACRGL (PARK2 Co-Regulated-Like (PACRGL))

Alternative Name: C4ORF28

Background: The function of Chromosome 4 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 24 kDa (MW of target protein)