WDR63 antibody (Middle Region)

Catalog No. ABIN632728

This Rabbit Polyclonal antibody specifically detects WDR63 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for WDR63 antibody (Middle Region) (ABIN632728)

Target: WDR63 (WD Repeat Domain 63 (WDR63))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR63 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-WDR63 Antibody

Binding Specificity: Middle Region

Specificity: WDR63 antibody was raised against the middle region of WDR63

Purification: Affinity purified

Immunogen: WDR63 antibody was raised using the middle region of WDR63 corresponding to a region with amino acids EIALQQNEIMNTFIDDWKYLAEEEGTFGDKTDTHLKEYQSFTDLHSPTEK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR63 Blocking Peptide, (ABIN937849), is also available for use as a blocking control in assays to test for specificity of this WDR63 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR63 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR63

Target: WDR63 (WD Repeat Domain 63 (WDR63))

Alternative Name: WDR63

Background: WDR63 contains 5 WD repeats. The exact function of WDR63 is not known.

Molecular Weight: 103 kDa (MW of target protein)