PDIK1L antibody (Middle Region)

Catalog No. ABIN632750

The Rabbit Polyclonal anti-PDIK1L antibody is suitable to detect PDIK1L in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for PDIK1L antibody (Middle Region) (ABIN632750)

Target: PDIK1L (PDLIM1 Interacting Kinase 1 Like (PDIK1L))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDIK1L antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDIK1L Antibody

Binding Specificity: Middle Region

Specificity: PDIK1 L antibody was raised against the middle region of PDIK1

Purification: Affinity purified

Immunogen: PDIK1 L antibody was raised using the middle region of PDIK1 corresponding to a region with amino acids FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDIK1L Blocking Peptide, (ABIN938256), is also available for use as a blocking control in assays to test for specificity of this PDIK1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDIK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDIK1L

Target: PDIK1L (PDLIM1 Interacting Kinase 1 Like (PDIK1L))

Alternative Name: PDIK1L

Background: The specific function of PDIK1L is not yet known.

Molecular Weight: 38 kDa (MW of target protein)