NADK2 antibody (Middle Region)

Catalog No. ABIN632753

The Rabbit Polyclonal anti-NADK2 antibody has been validated for WB. It is suitable to detect NADK2 in samples from Human, Mouse and Rat.

Quick Overview for NADK2 antibody (Middle Region) (ABIN632753)

Target: NADK2 (NAD Kinase 2, Mitochondrial (NADK2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NADK2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NADK2 Antibody

Binding Specificity: Middle Region

Specificity: C5 ORF33 antibody was raised against the middle region of C5 rf33

Purification: Affinity purified

Immunogen: C5 ORF33 antibody was raised using the middle region of C5 rf33 corresponding to a region with amino acids RWLWRQRIRLYLEGTGINPVPVDLHEQQLSLNQHNRALNIERAHDERSEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C5ORF33 Blocking Peptide, (ABIN5612525), is also available for use as a blocking control in assays to test for specificity of this C5ORF33 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NADK2

Target: NADK2 (NAD Kinase 2, Mitochondrial (NADK2))

Alternative Name: C5ORF33

Background: The specific function of C5orf33 is not yet known.

Molecular Weight: 49 kDa (MW of target protein)