IQCK antibody (Middle Region)

Catalog No. ABIN632754

This anti-IQCK antibody is a Rabbit Polyclonal antibody detecting IQCK in WB. Suitable for Human and Rat.

Quick Overview for IQCK antibody (Middle Region) (ABIN632754)

Target: IQCK (IQ Motif Containing K (IQCK))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IQCK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IQCK Antibody

Binding Specificity: Middle Region

Specificity: IQCK antibody was raised against the middle region of IQCK

Purification: Affinity purified

Immunogen: IQCK antibody was raised using the middle region of IQCK corresponding to a region with amino acids GMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IQCK Blocking Peptide, (ABIN938819), is also available for use as a blocking control in assays to test for specificity of this IQCK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IQCK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IQCK

Target: IQCK (IQ Motif Containing K (IQCK))

Alternative Name: IQCK

Background: The function of IQC protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 33 kDa (MW of target protein)