LACC1 antibody (Middle Region)

Catalog No. ABIN632755

This Rabbit Polyclonal antibody specifically detects LACC1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for LACC1 antibody (Middle Region) (ABIN632755)

Target: LACC1 (C13orf31) (Chromosome 13 Open Reading Frame 31 (C13orf31))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LACC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LACC1 Antibody

Binding Specificity: Middle Region

Specificity: C13 ORF31 antibody was raised against the middle region of C13 rf31

Purification: Affinity purified

Immunogen: C13 ORF31 antibody was raised using the middle region of C13 rf31 corresponding to a region with amino acids TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C13ORF31 Blocking Peptide, (ABIN5612402), is also available for use as a blocking control in assays to test for specificity of this C13ORF31 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LACC1

Target: LACC1 (C13orf31) (Chromosome 13 Open Reading Frame 31 (C13orf31))

Alternative Name: C13ORF31

Background: The function of C13orf31 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 48 kDa (MW of target protein)