PSTK antibody (Middle Region)

Catalog No. ABIN632756

The Rabbit Polyclonal anti-PSTK antibody has been validated for WB. It is suitable to detect PSTK in samples from Human, Mouse and Rat.

Quick Overview for PSTK antibody (Middle Region) (ABIN632756)

Target: PSTK (Phosphoseryl-tRNA Kinase (PSTK))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSTK antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PSTK Antibody

Binding Specificity: Middle Region

Specificity: PSTK antibody was raised against the middle region of PSTK

Purification: Affinity purified

Immunogen: PSTK antibody was raised using the middle region of PSTK corresponding to a region with amino acids SRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSTK Blocking Peptide, (ABIN5615643), is also available for use as a blocking control in assays to test for specificity of this PSTK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSTK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSTK

Target: PSTK (Phosphoseryl-tRNA Kinase (PSTK))

Alternative Name: PSTK

Background: PSTK specifically phosphorylates seryl-tRNA(Sec) to O-phosphoseryl-tRNA(Sec), an activated intermediate for selenocysteine biosynthesis.

Molecular Weight: 39 kDa (MW of target protein)