C5orf35 antibody (N-Term)

Catalog No. ABIN632765

The Rabbit Polyclonal anti-C5orf35 antibody has been validated for WB. It is suitable to detect C5orf35 in samples from Human.

Quick Overview for C5orf35 antibody (N-Term) (ABIN632765)

Target: C5orf35 (Chromosome 5 Open Reading Frame 35 (C5orf35))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C5orf35 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C5orf35 Antibody

Binding Specificity: N-Term

Specificity: C5 ORF35 antibody was raised against the N terminal Of C5 rf35

Purification: Affinity purified

Immunogen: C5 ORF35 antibody was raised using the N terminal Of C5 rf35 corresponding to a region with amino acids QSEILTMLPESVKSKYQDLLAVEHQGVKLRENRHQQQSTFKPEEILYKTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C5ORF35 Blocking Peptide, (ABIN5612526), is also available for use as a blocking control in assays to test for specificity of this C5ORF35 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C5orf35

Target: C5orf35 (Chromosome 5 Open Reading Frame 35 (C5orf35))

Alternative Name: C5ORF35

Background: The function of C5orf35 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 34 kDa (MW of target protein)