CCDC60 antibody (C-Term)

Catalog No. ABIN632771

The Rabbit Polyclonal anti-CCDC60 antibody has been validated for WB. It is suitable to detect CCDC60 in samples from Rat, Mouse and Human.

Quick Overview for CCDC60 antibody (C-Term) (ABIN632771)

Target: CCDC60 (Coiled-Coil Domain Containing 60 (CCDC60))

Reactivity: Rat, Mouse, Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC60 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCDC60 Antibody

Binding Specificity: C-Term

Specificity: CCDC60 antibody was raised against the C terminal of CCDC60

Purification: Affinity purified

Immunogen: CCDC60 antibody was raised using the C terminal of CCDC60 corresponding to a region with amino acids RPAKKILVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC60 Blocking Peptide, (ABIN5612712), is also available for use as a blocking control in assays to test for specificity of this CCDC60 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC60 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC60

Target: CCDC60 (Coiled-Coil Domain Containing 60 (CCDC60))

Alternative Name: CCDC60

Background: The function of CCDC60 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 63 kDa (MW of target protein)