DNAJC24 antibody (N-Term)

Catalog No. ABIN632772

The Rabbit Polyclonal anti-DNAJC24 antibody (ABIN632772) specifically detects DNAJC24 in WB. The antibody is reactive with Human samples.

Quick Overview for DNAJC24 antibody (N-Term) (ABIN632772)

Target: DNAJC24 (DnaJ (Hsp40) Homolog, Subfamily C, Member 24 (DNAJC24))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJC24 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DNAJC24 Antibody

Binding Specificity: N-Term

Specificity: DPH4 antibody was raised against the N terminal Of Dph4

Purification: Affinity purified

Immunogen: DPH4 antibody was raised using the N terminal Of Dph4 corresponding to a region with amino acids MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DPH4 Blocking Peptide, (ABIN5613246), is also available for use as a blocking control in assays to test for specificity of this DPH4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJC24

Target: DNAJC24 (DnaJ (Hsp40) Homolog, Subfamily C, Member 24 (DNAJC24))

Alternative Name: DPH4

Background: Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 . This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH4 is 1 of several enzymes involved in synthesis of diphthamide in EEF2.

Molecular Weight: 17 kDa (MW of target protein)