FAM116A antibody (Middle Region)

Catalog No. ABIN632778

The Rabbit Polyclonal anti-FAM116A antibody (ABIN632778) specifically detects FAM116A in WB. The antibody is reactive with Human and Rat samples.

Quick Overview for FAM116A antibody (Middle Region) (ABIN632778)

Target: FAM116A (Family with Sequence Similarity 116, Member A (FAM116A))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM116A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM116A Antibody

Binding Specificity: Middle Region

Specificity: FAM116 A antibody was raised against the middle region of FAM116

Purification: Affinity purified

Immunogen: FAM116 A antibody was raised using the middle region of FAM116 corresponding to a region with amino acids KPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM116A Blocking Peptide, (ABIN939971), is also available for use as a blocking control in assays to test for specificity of this FAM116A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM116A

Target: FAM116A (Family with Sequence Similarity 116, Member A (FAM116A))

Alternative Name: FAM116A

Background: FAM116A belongs to the FAM116 family. The exact function of FAM116A remains unknown.

Molecular Weight: 67 kDa (MW of target protein)