CCDC7 antibody (N-Term)

Catalog No. ABIN632784

This anti-CCDC7 antibody is a Rabbit Polyclonal antibody detecting CCDC7 in WB. Suitable for Human.

Quick Overview for CCDC7 antibody (N-Term) (ABIN632784)

Target: CCDC7 (Coiled-Coil Domain Containing 7 (CCDC7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCDC7 Antibody

Binding Specificity: N-Term

Specificity: CCDC7 antibody was raised against the N terminal of CCDC7

Purification: Affinity purified

Immunogen: CCDC7 antibody was raised using the N terminal of CCDC7 corresponding to a region with amino acids KHNAKLIHDKIEPMVLRSPPTGESILRYALPIPSSKTKNLLPEDEMIGKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC7 Blocking Peptide, (ABIN939801), is also available for use as a blocking control in assays to test for specificity of this CCDC7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC7

Target: CCDC7 (Coiled-Coil Domain Containing 7 (CCDC7))

Alternative Name: CCDC7

Background: The function of CCDC7 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 56 kDa (MW of target protein)