HINT1 antibody (N-Term)

Catalog No. ABIN632794

This Rabbit Polyclonal antibody specifically detects HINT1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for HINT1 antibody (N-Term) (ABIN632794)

Target: HINT1 (Histidine Triad Nucleotide Binding Protein 1 (HINT1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HINT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HINT1 Antibody

Binding Specificity: N-Term

Specificity: HINT1 antibody was raised against the N terminal of HINT1

Purification: Affinity purified

Immunogen: HINT1 antibody was raised using the N terminal of HINT1 corresponding to a region with amino acids ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HINT1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this HINT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HINT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HINT1

Target: HINT1 (Histidine Triad Nucleotide Binding Protein 1 (HINT1))

Alternative Name: HINT1

Background: HINT1 hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.

Molecular Weight: 14 kDa (MW of target protein)