AKR7A3 antibody

Catalog No. ABIN632796

This anti-AKR7A3 antibody is a Rabbit Polyclonal antibody detecting AKR7A3 in WB. Suitable for Human.

Quick Overview for AKR7A3 antibody (ABIN632796)

Target: AKR7A3 (Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKR7A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AKR7A3 Antibody

Purification: Affinity purified

Immunogen: AKR7 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKR7A3 Blocking Peptide, (ABIN5611994), is also available for use as a blocking control in assays to test for specificity of this AKR7A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AKR7A3

Target: AKR7A3 (Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3))

Alternative Name: AKR7A3

Background: Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.

Molecular Weight: 37 kDa (MW of target protein)