PDXDC1 antibody (N-Term)

Catalog No. ABIN632806

This Rabbit Polyclonal antibody specifically detects PDXDC1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for PDXDC1 antibody (N-Term) (ABIN632806)

Target: PDXDC1 (Pyridoxal-Dependent Decarboxylase Domain Containing 1 (PDXDC1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDXDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PDXDC1 Antibody

Binding Specificity: N-Term

Specificity: PDXDC1 antibody was raised against the N terminal of PDXDC1

Purification: Affinity purified

Immunogen: PDXDC1 antibody was raised using the N terminal of PDXDC1 corresponding to a region with amino acids DEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDXDC1 Blocking Peptide, (ABIN937279), is also available for use as a blocking control in assays to test for specificity of this PDXDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDXDC1

Target: PDXDC1 (Pyridoxal-Dependent Decarboxylase Domain Containing 1 (PDXDC1))

Alternative Name: PDXDC1

Background: PDXDC1 belongs to the group II decarboxylase family. The function of PDXDC1 remains unknown.

Molecular Weight: 87 kDa (MW of target protein)