LSM14A antibody

Catalog No. ABIN632816

The Rabbit Polyclonal anti-LSM14A antibody is suitable to detect LSM14A in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for LSM14A antibody (ABIN632816)

Target: LSM14A (LSM14A, SCD6 Homolog A (LSM14A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LSM14A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LSM14A Antibody

Purification: Affinity purified

Immunogen: LSM14 A antibody was raised using a synthetic peptide corresponding to a region with amino acids KLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LSM14A Blocking Peptide, (ABIN939891), is also available for use as a blocking control in assays to test for specificity of this LSM14A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LSM10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LSM14A

Target: LSM14A (LSM14A, SCD6 Homolog A (LSM14A))

Alternative Name: LSM14A

Background: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family. Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Ribonucleoprotein Complex Subunit Organization