PXT1 antibody (Middle Region)

Catalog No. ABIN632826

This anti-PXT1 antibody is a Rabbit Polyclonal antibody detecting PXT1 in WB. Suitable for Human.

Quick Overview for PXT1 antibody (Middle Region) (ABIN632826)

Target: PXT1 (Peroxisomal, Testis Specific 1 (PXT1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PXT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PXT1 Antibody

Binding Specificity: Middle Region

Specificity: PXT1 antibody was raised against the middle region of PXT1

Purification: Affinity purified

Immunogen: PXT1 antibody was raised using the middle region of PXT1 corresponding to a region with amino acids MQLRHIGDNIDHRMVREDLQQDGRDALDHFVFFFFRRVQVLLHFFWNNHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PXT1 Blocking Peptide, (ABIN5615689), is also available for use as a blocking control in assays to test for specificity of this PXT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PXT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PXT1

Target: PXT1 (Peroxisomal, Testis Specific 1 (PXT1))

Alternative Name: PXT1

Background: The function of PXT1 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 6 kDa (MW of target protein)