TRIML2 antibody (Middle Region)

Catalog No. ABIN632830

This Rabbit Polyclonal antibody specifically detects TRIML2 in WB. It exhibits reactivity toward Human.

Quick Overview for TRIML2 antibody (Middle Region) (ABIN632830)

Target: TRIML2 (Tripartite Motif Family-Like 2 (TRIML2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRIML2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRIML2 Antibody

Binding Specificity: Middle Region

Specificity: TRIML2 antibody was raised against the middle region of TRIML2

Purification: Affinity purified

Immunogen: TRIML2 antibody was raised using the middle region of TRIML2 corresponding to a region with amino acids SEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFTSGRHYWEVDVEKAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRIML2 Blocking Peptide, (ABIN5616791), is also available for use as a blocking control in assays to test for specificity of this TRIML2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIML2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRIML2

Target: TRIML2 (Tripartite Motif Family-Like 2 (TRIML2))

Alternative Name: TRIML2

Background: The specific function of TRIML2 is not yet known.

Molecular Weight: 44 kDa (MW of target protein)