FAM131C antibody (Middle Region)
-
- Target See all FAM131C products
- FAM131C (Family with Sequence Similarity 131, Member C (FAM131C))
- Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM131C antibody is un-conjugated
- Application
- Western Blotting (WB)
- Specificity
- FAM131 C antibody was raised against the middle region of FAM131
- Purification
- Affinity purified
- Immunogen
- FAM131 C antibody was raised using the middle region of FAM131 corresponding to a region with amino acids RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM131C Blocking Peptide, catalog no. 33R-7936, is also available for use as a blocking control in assays to test for specificity of this FAM131C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM130 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM131C (Family with Sequence Similarity 131, Member C (FAM131C))
- Alternative Name
- FAM131C (FAM131C Products)
- Background
- The function of FAM131 protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 30 kDa (MW of target protein)
-