WDR53 antibody (Middle Region)

Catalog No. ABIN632845

This Rabbit Polyclonal antibody specifically detects WDR53 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for WDR53 antibody (Middle Region) (ABIN632845)

Target: WDR53 (WD Repeat Domain 53 (WDR53))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR53 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-WDR53 Antibody

Binding Specificity: Middle Region

Specificity: WDR53 antibody was raised against the middle region of WDR53

Purification: Affinity purified

Immunogen: WDR53 antibody was raised using the middle region of WDR53 corresponding to a region with amino acids NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR53 Blocking Peptide, (ABIN5617000), is also available for use as a blocking control in assays to test for specificity of this WDR53 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR53 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR53

Target: WDR53 (WD Repeat Domain 53 (WDR53))

Alternative Name: WDR53

Background: The function of WDR53 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 39 kDa (MW of target protein)