HDDC3 antibody (Middle Region)

Catalog No. ABIN632847

Product Details anti-HDDC3 Antibody

Target: HDDC3 (HD Domain Containing 3 (HDDC3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HDDC3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HDDC3 antibody was raised against the middle region of HDDC3

Purification: Affinity purified

Immunogen: HDDC3 antibody was raised using the middle region of HDDC3 corresponding to a region with amino acids TDDKTLPKLERKRLQVEQAPHSSPGAKLVKLADKLYNLRDLNRCTPEVKI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HDDC3 Blocking Peptide, catalog no. 33R-9007, is also available for use as a blocking control in assays to test for specificity of this HDDC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HDDC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HDDC3

Target: HDDC3 (HD Domain Containing 3 (HDDC3))

Alternative Name: HDDC3 (HDDC3 Products)

Synonyms: MESH1 antibody, zgc:110184 antibody, 1110033O09Rik antibody, C86475 antibody, RGD1311839 antibody, HD domain containing 3 antibody, HD domain containing 3 S homeolog antibody, hddc3 antibody, HDDC3 antibody, hddc3.S antibody, Hddc3 antibody

Background: The function of HDDC3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 16 kDa (MW of target protein)