IER5L antibody (Middle Region)

Catalog No. ABIN632857

This Rabbit Polyclonal antibody specifically detects IER5L in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for IER5L antibody (Middle Region) (ABIN632857)

Target: IER5L (Immediate Early Response 5-Like (IER5L))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IER5L antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IER5L Antibody

Binding Specificity: Middle Region

Specificity: IER5 L antibody was raised against the middle region of IER5

Purification: Affinity purified

Immunogen: IER5 L antibody was raised using the middle region of IER5 corresponding to a region with amino acids SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IER5L Blocking Peptide, (ABIN5614139), is also available for use as a blocking control in assays to test for specificity of this IER5L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IER0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IER5L

Target: IER5L (Immediate Early Response 5-Like (IER5L))

Alternative Name: IER5L

Background: The function of IER5 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 42 kDa (MW of target protein)