DDI1 antibody

Catalog No. ABIN632869

This Rabbit Polyclonal antibody specifically detects DDI1 in WB. It exhibits reactivity toward Human.

Quick Overview for DDI1 antibody (ABIN632869)

Target: DDI1 (DNA-Damage Inducible 1 Homolog 1 (DDI1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DDI1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DDI1 Antibody

Purification: Affinity purified

Immunogen: DDI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNVLVIGTTGTQTYFLPEGELPLCSRMVSGQDESSDKEITHSVMDSGRKE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DDI1 Blocking Peptide, (ABIN939962), is also available for use as a blocking control in assays to test for specificity of this DDI1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DDI1

Target: DDI1 (DNA-Damage Inducible 1 Homolog 1 (DDI1))

Alternative Name: DDI1

Background: The function of DDI1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 44 kDa (MW of target protein)