PBLD1 antibody (Phenazine Biosynthesis-Like Protein Domain Containing 1) (N-Term)

Details for Product anti-PBLD1 Antibody No. ABIN632880
Antigen
Epitope
N-Term
15
10
9
7
4
3
2
Reactivity
Human
59
18
17
2
2
1
1
1
1
1
Host
Rabbit
41
18
Clonality
Polyclonal
Conjugate
This PBLD1 antibody is un-conjugated
4
4
4
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
44
25
13
6
4
3
3
Options
Immunogen PBLD antibody was raised using the N terminal of PBLD corresponding to a region with amino acids KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR
Specificity PBLD antibody was raised against the N terminal of PBLD
Purification Affinity purified
Antigen
Alternative Name PBLD (PBLD1 Antibody Abstract)
Background The function of the PBLD protein has not been widely studied, and is yet to be fully elucidated.
Molecular Weight 31 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

PBLD Blocking Peptide, catalog no. 33R-4526, is also available for use as a blocking control in assays to test for specificity of this PBLD antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PBLD antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Phenazine Biosynthesis-Like Protein Domain Containing 1 (PBLD1) (N-Term) antibody (ABIN632880) PBLD antibody used at 1 ug/ml to detect target protein.