C9orf68 antibody (Middle Region)

Catalog No. ABIN632882

The Rabbit Polyclonal anti-C9orf68 antibody has been validated for WB. It is suitable to detect C9orf68 in samples from Human.

Quick Overview for C9orf68 antibody (Middle Region) (ABIN632882)

Target: C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C9orf68 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C9orf68 Antibody

Binding Specificity: Middle Region

Specificity: C9 ORF68 antibody was raised against the middle region of C9 rf68

Purification: Affinity purified

Immunogen: C9 ORF68 antibody was raised using the middle region of C9 rf68 corresponding to a region with amino acids CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C9ORF68 Blocking Peptide, (ABIN937119), is also available for use as a blocking control in assays to test for specificity of this C9ORF68 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF68 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C9orf68

Target: C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))

Alternative Name: C9ORF68

Background: The function of Chromosome 9 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 45 kDa (MW of target protein)