C9orf68 antibody (Middle Region)
-
- Target See all C9orf68 products
- C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))
-
Binding Specificity
- Middle Region
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This C9orf68 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C9 ORF68 antibody was raised against the middle region of C9 rf68
- Purification
- Affinity purified
- Immunogen
- C9 ORF68 antibody was raised using the middle region of C9 rf68 corresponding to a region with amino acids CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C9ORF68 Blocking Peptide, catalog no. 33R-1733, is also available for use as a blocking control in assays to test for specificity of this C9ORF68 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF68 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C9orf68 (Chromosome 9 Open Reading Frame 68 (C9orf68))
- Alternative Name
- C9ORF68 (C9orf68 Products)
- Synonyms
- MGC131199 antibody, MGC146453 antibody, C9orf68 antibody, bA6J24.2 antibody, spermatogenesis associated 6-like L homeolog antibody, spermatogenesis associated 6-like antibody, spermatogenesis associated 6 like antibody, spata6l.L antibody, spata6l antibody, SPATA6L antibody
- Background
- The function of Chromosome 9 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 45 kDa (MW of target protein)
-