C22orf28 antibody (Middle Region)

Catalog No. ABIN632912

Product Details anti-C22orf28 Antibody

Target: C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C22orf28 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C22 ORF28 antibody was raised against the middle region of C22 rf28

Purification: Affinity purified

Immunogen: C22 ORF28 antibody was raised using the middle region of C22 rf28 corresponding to a region with amino acids EQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C22ORF28 Blocking Peptide, catalog no. 33R-2666, is also available for use as a blocking control in assays to test for specificity of this C22ORF28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C22orf28

Target: C22orf28 (Chromosome 22 Open Reading Frame 28 (C22orf28))

Alternative Name: C22ORF28 (C22orf28 Products)

Synonyms: C1H22orf28 antibody, C22orf28 antibody, DJ149A16.6 antibody, FAAP antibody, RP1-149A16.6 antibody, c22orf28 antibody, C10H22orf28 antibody, MGC154502 antibody, HSPC117 antibody, AI255213 antibody, AI463255 antibody, RNA 2',3'-cyclic phosphate and 5'-OH ligase antibody, tRNA-splicing ligase RtcB homolog antibody, RTCB antibody, rtcb antibody, rtcb.L antibody, Rtcb antibody

Background: C22ORF28 is believed to be involved in vinculin binding.

Molecular Weight: 55 kDa (MW of target protein)