RPS27L antibody (N-Term)

Catalog No. ABIN632914

This Rabbit Polyclonal antibody specifically detects RPS27L in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for RPS27L antibody (N-Term) (ABIN632914)

Target: RPS27L (Ribosomal Protein S27L (RPS27L))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS27L antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RPS27L Antibody

Binding Specificity: N-Term

Specificity: RPS27 L antibody was raised against the N terminal of RPS27

Purification: Affinity purified

Immunogen: RPS27 L antibody was raised using the N terminal of RPS27 corresponding to a region with amino acids MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS27L Blocking Peptide, (ABIN5615950), is also available for use as a blocking control in assays to test for specificity of this RPS27L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS27L

Target: RPS27L (Ribosomal Protein S27L (RPS27L))

Alternative Name: RPS27L

Background: This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit.

Molecular Weight: 9 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity