CXorf26 antibody (Middle Region)

Catalog No. ABIN632923

This Rabbit Polyclonal antibody specifically detects CXorf26 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for CXorf26 antibody (Middle Region) (ABIN632923)

Target: CXorf26 (Chromosome X Open Reading Frame 26 (CXorf26))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CXorf26 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CXorf26 Antibody

Binding Specificity: Middle Region

Specificity: CXORF26 antibody was raised against the middle region of Cxorf26

Purification: Affinity purified

Immunogen: CXORF26 antibody was raised using the middle region of Cxorf26 corresponding to a region with amino acids IYSEFRKNFETLRIDVLDPEELKSESAKEKWRPFCLKFNGIVEDFNYGTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CXORF26 Blocking Peptide, (ABIN939612), is also available for use as a blocking control in assays to test for specificity of this CXORF26 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF26 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CXorf26

Target: CXorf26 (Chromosome X Open Reading Frame 26 (CXorf26))

Alternative Name: CXORF26

Background: The function of Chromosome X ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 26 kDa (MW of target protein)