CHCHD3 antibody (N-Term)

Catalog No. ABIN632928

The Rabbit Polyclonal anti-CHCHD3 antibody (ABIN632928) specifically detects CHCHD3 in WB. The antibody is reactive with Human samples.

Quick Overview for CHCHD3 antibody (N-Term) (ABIN632928)

Target: CHCHD3 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHCHD3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHCHD3 Antibody

Binding Specificity: N-Term

Specificity: CHCHD3 antibody was raised against the N terminal of CHCHD3

Purification: Affinity purified

Immunogen: CHCHD3 antibody was raised using the N terminal of CHCHD3 corresponding to a region with amino acids RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHCHD3 Blocking Peptide, (ABIN5612839), is also available for use as a blocking control in assays to test for specificity of this CHCHD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHCHD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHCHD3

Target: CHCHD3 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 3 (CHCHD3))

Alternative Name: CHCHD3

Background: ChChd3 is an inner mitochondrial membrane protein and is essential for maintaining crista integrity and mitochondrial function.

Molecular Weight: 26 kDa (MW of target protein)