Chromosome 14 Open Reading Frame 104 (C14orf104) (N-Term) antibody

Details for Product No. ABIN632937
Western Blotting (WB)
Immunogen C14 ORF104 antibody was raised using the N terminal Of C14 rf104 corresponding to a region with amino acids MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG
Specificity C14 ORF104 antibody was raised against the N terminal Of C14 rf104
Purification Affinity purified
Alternative Name C14ORF104 (C14orf104 Antibody Abstract)
Background This protein is highly conserved and involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 91 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

C14ORF104 Blocking Peptide, catalog no. 33R-6005, is also available for use as a blocking control in assays to test for specificity of this C14ORF104 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF104 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Chromosome 14 Open Reading Frame 104 (C14orf104) (N-Term) antibody (ABIN632937) C14ORF104 antibody used at 1 ug/ml to detect target protein.