RIC8B antibody

Catalog No. ABIN632940

This anti-RIC8B antibody is a Rabbit Polyclonal antibody detecting RIC8B in WB. Suitable for Human, Mouse and Rat.

Quick Overview for RIC8B antibody (ABIN632940)

Target: RIC8B (Resistance To Inhibitors of Cholinesterase 8 Homolog B (RIC8B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RIC8B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RIC8B Antibody

Purification: Affinity purified

Immunogen: RIC8 B antibody was raised using a synthetic peptide corresponding to a region with amino acids KETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RIC8B Blocking Peptide, (ABIN939747), is also available for use as a blocking control in assays to test for specificity of this RIC8B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RIC8B

Target: RIC8B (Resistance To Inhibitors of Cholinesterase 8 Homolog B (RIC8B))

Alternative Name: RIC8B

Background: RIC8B is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP (By similarity). Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.

Molecular Weight: 59 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling