CCDC87 antibody (N-Term)

Catalog No. ABIN632942

The Rabbit Polyclonal anti-CCDC87 antibody has been validated for WB. It is suitable to detect CCDC87 in samples from Human.

Quick Overview for CCDC87 antibody (N-Term) (ABIN632942)

Target: CCDC87 (Coiled-Coil Domain Containing 87 (CCDC87))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCDC87 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CCDC87 Antibody

Binding Specificity: N-Term

Specificity: CCDC87 antibody was raised against the N terminal of CCDC87

Purification: Affinity purified

Immunogen: CCDC87 antibody was raised using the N terminal of CCDC87 corresponding to a region with amino acids MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCDC87 Blocking Peptide, (ABIN5612718), is also available for use as a blocking control in assays to test for specificity of this CCDC87 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC87 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCDC87

Target: CCDC87 (Coiled-Coil Domain Containing 87 (CCDC87))

Alternative Name: CCDC87

Background: The function of CCDC87 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 96 kDa (MW of target protein)