GLRX3 antibody (N-Term)

Catalog No. ABIN632963

The Rabbit Polyclonal anti-GLRX3 antibody has been validated for WB. It is suitable to detect GLRX3 in samples from Human.

Quick Overview for GLRX3 antibody (N-Term) (ABIN632963)

Target: GLRX3 (Glutaredoxin 3 (GLRX3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLRX3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GLRX3 Antibody

Binding Specificity: N-Term

Specificity: GLRX3 antibody was raised against the N terminal of GLRX3

Purification: Affinity purified

Immunogen: GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLRX3 Blocking Peptide, (ABIN5613786), is also available for use as a blocking control in assays to test for specificity of this GLRX3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLRX3

Target: GLRX3 (Glutaredoxin 3 (GLRX3))

Alternative Name: GLRX3

Background: GLRX3 may play a role in regulating the function of the thioredoxin system.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis