FBXO15 antibody (N-Term)

Catalog No. ABIN632966

The Rabbit Polyclonal anti-FBXO15 antibody has been validated for WB. It is suitable to detect FBXO15 in samples from Human and Rat.

Quick Overview for FBXO15 antibody (N-Term) (ABIN632966)

Target: FBXO15 (F-Box Protein 15 (FBXO15))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBXO15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FBXO15 Antibody

Binding Specificity: N-Term

Specificity: FBXO15 antibody was raised against the N terminal of FBXO15

Purification: Affinity purified

Immunogen: FBXO15 antibody was raised using the N terminal of FBXO15 corresponding to a region with amino acids QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBXO15 Blocking Peptide, (ABIN5613535), is also available for use as a blocking control in assays to test for specificity of this FBXO15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBXO15

Target: FBXO15 (F-Box Protein 15 (FBXO15))

Alternative Name: FBXO15

Background: FBXO15 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO15, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Molecular Weight: 49 kDa (MW of target protein)