FAM36A antibody (Middle Region)
-
- Target See all FAM36A products
- FAM36A (Family with Sequence Similarity 36, Member A (FAM36A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FAM36A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FAM36 A antibody was raised against the middle region of FAM36
- Purification
- Affinity purified
- Immunogen
- FAM36 A antibody was raised using the middle region of FAM36 corresponding to a region with amino acids LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FAM36A Blocking Peptide, catalog no. 33R-4967, is also available for use as a blocking control in assays to test for specificity of this FAM36A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM36A (Family with Sequence Similarity 36, Member A (FAM36A))
- Alternative Name
- FAM36A (FAM36A Products)
- Background
- FAM36A is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of FAM36A remains unknown.
- Molecular Weight
- 13 kDa (MW of target protein)
-