IPP antibody (C-Term)

Catalog No. ABIN632969

The Rabbit Polyclonal anti-IPP antibody has been validated for WB. It is suitable to detect IPP in samples from Human, Rat and Mouse.

Quick Overview for IPP antibody (C-Term) (ABIN632969)

Target: IPP (Intracisternal A Particle-Promoted Polypeptide (IPP))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IPP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-IPP Antibody

Binding Specificity: C-Term

Specificity: IPP antibody was raised against the C terminal of IPP

Purification: Affinity purified

Immunogen: IPP antibody was raised using the C terminal of IPP corresponding to a region with amino acids EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IPP Blocking Peptide, (ABIN937978), is also available for use as a blocking control in assays to test for specificity of this IPP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IPP

Target: IPP (Intracisternal A Particle-Promoted Polypeptide (IPP))

Alternative Name: IPP

Background: IPP is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin.

Molecular Weight: 65 kDa (MW of target protein)