IPP antibody (C-Term)
-
- Target See all IPP Antibodies
- IPP (Intracisternal A Particle-Promoted Polypeptide (IPP))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IPP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IPP antibody was raised against the C terminal of IPP
- Purification
- Affinity purified
- Immunogen
- IPP antibody was raised using the C terminal of IPP corresponding to a region with amino acids EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL
- Top Product
- Discover our top product IPP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IPP Blocking Peptide, catalog no. 33R-2592, is also available for use as a blocking control in assays to test for specificity of this IPP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IPP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IPP (Intracisternal A Particle-Promoted Polypeptide (IPP))
- Alternative Name
- IPP (IPP Products)
- Background
- IPP is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin.
- Molecular Weight
- 65 kDa (MW of target protein)
-