RFESD antibody

Catalog No. ABIN632977

This Rabbit Polyclonal antibody specifically detects RFESD in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for RFESD antibody (ABIN632977)

Target: RFESD (Rieske (Fe-S) Domain Containing (RFESD))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RFESD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RFESD Antibody

Purification: Affinity purified

Immunogen: RFESD antibody was raised using a synthetic peptide corresponding to a region with amino acids VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RFESD Blocking Peptide, (ABIN5615834), is also available for use as a blocking control in assays to test for specificity of this RFESD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFESD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RFESD

Target: RFESD (Rieske (Fe-S) Domain Containing (RFESD))

Alternative Name: RFESD

Background: The function of RFESD protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 18 kDa (MW of target protein)