C15orf26/CFAP161 antibody (C-Term)

Catalog No. ABIN632983

This Rabbit Polyclonal antibody specifically detects C15orf26/CFAP161 in WB. It exhibits reactivity toward Human.

Quick Overview for C15orf26/CFAP161 antibody (C-Term) (ABIN632983)

Target: C15orf26/CFAP161 (C15orf26) (Chromosome 15 Open Reading Frame 26 (C15orf26))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C15orf26/CFAP161 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C15orf26/CFAP161 Antibody

Binding Specificity: C-Term

Specificity: C15 ORF26 antibody was raised against the C terminal Of C15 rf26

Purification: Affinity purified

Immunogen: C15 ORF26 antibody was raised using the C terminal Of C15 rf26 corresponding to a region with amino acids LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C15ORF26 Blocking Peptide, (ABIN940442), is also available for use as a blocking control in assays to test for specificity of this C15ORF26 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF26 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C15orf26/CFAP161

Target: C15orf26/CFAP161 (C15orf26) (Chromosome 15 Open Reading Frame 26 (C15orf26))

Alternative Name: C15ORF26

Background: The function of C15orf26 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 34 kDa (MW of target protein)