C9orf43 antibody (Middle Region)

Catalog No. ABIN632984

The Rabbit Polyclonal anti-C9orf43 antibody has been validated for WB. It is suitable to detect C9orf43 in samples from Human.

Quick Overview for C9orf43 antibody (Middle Region) (ABIN632984)

Target: C9orf43 (Chromosome 9 Open Reading Frame 43 (C9orf43))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C9orf43 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C9orf43 Antibody

Binding Specificity: Middle Region

Specificity: C9 ORF43 antibody was raised against the middle region of C9 rf43

Purification: Affinity purified

Immunogen: C9 ORF43 antibody was raised using the middle region of C9 rf43 corresponding to a region with amino acids PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C9ORF43 Blocking Peptide, (ABIN5612550), is also available for use as a blocking control in assays to test for specificity of this C9ORF43 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF43 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C9orf43

Target: C9orf43 (Chromosome 9 Open Reading Frame 43 (C9orf43))

Alternative Name: C9ORF43

Background: The function of the C9orf43 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 52 kDa (MW of target protein)