LACTB2 antibody (Middle Region)

Catalog No. ABIN632991

This anti-LACTB2 antibody is a Rabbit Polyclonal antibody detecting LACTB2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for LACTB2 antibody (Middle Region) (ABIN632991)

Target: LACTB2 (Lactamase, beta 2 (LACTB2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LACTB2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LACTB2 Antibody

Binding Specificity: Middle Region

Specificity: Beta Lactamase 2 antibody was raised against the middle region of LACTB2

Purification: Affinity purified

Immunogen: Beta Lactamase 2 antibody was raised using the middle region of LACTB2 corresponding to a region with amino acids NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Beta Lactamase 2 Blocking Peptide, (ABIN5612322), is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LACTB2

Target: LACTB2 (Lactamase, beta 2 (LACTB2))

Background: The specific function of LACTB2 is not yet known.

Molecular Weight: 33 kDa (MW of target protein)