LYSMD2 antibody (Middle Region)

Catalog No. ABIN632998

This Rabbit Polyclonal antibody specifically detects LYSMD2 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for LYSMD2 antibody (Middle Region) (ABIN632998)

Target: LYSMD2 (LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYSMD2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LYSMD2 Antibody

Binding Specificity: Middle Region

Specificity: LYSMD2 antibody was raised against the middle region of LYSMD2

Purification: Affinity purified

Immunogen: LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYSMD2 Blocking Peptide, (ABIN5614617), is also available for use as a blocking control in assays to test for specificity of this LYSMD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYSMD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYSMD2

Target: LYSMD2 (LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2))

Alternative Name: LYSMD2

Background: The function of LYSMD2 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 23 kDa (MW of target protein)