KANK3 antibody (N-Term)

Catalog No. ABIN632999

The Rabbit Polyclonal anti-KANK3 antibody has been validated for WB. It is suitable to detect KANK3 in samples from Human, Mouse and Rat.

Quick Overview for KANK3 antibody (N-Term) (ABIN632999)

Target: KANK3 (KN Motif and Ankyrin Repeat Domains 3 (KANK3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KANK3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KANK3 Antibody

Binding Specificity: N-Term

Specificity: ANKRD47 antibody was raised against the N terminal Of Ankrd47

Purification: Affinity purified

Immunogen: ANKRD47 antibody was raised using the N terminal Of Ankrd47 corresponding to a region with amino acids MAKFALNQNLPDLGGPRLCPVPAAGGARSPSSPYSVETPYGFHLDLDFLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKRD47 Blocking Peptide, (ABIN5612068), is also available for use as a blocking control in assays to test for specificity of this ANKRD47 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KANK3

Target: KANK3 (KN Motif and Ankyrin Repeat Domains 3 (KANK3))

Alternative Name: ANKRD47

Background: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 86 kDa (MW of target protein)