PEF1 antibody (Middle Region)

Catalog No. ABIN633001

Product Details anti-PEF1 Antibody

Target: PEF1 (Penta-EF-Hand Domain Containing 1 (PEF1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PEF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PEF1 antibody was raised against the middle region of PEF1

Purification: Affinity purified

Immunogen: PEF1 antibody was raised using the middle region of PEF1 corresponding to a region with amino acids WKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PEF1 Blocking Peptide, catalog no. 33R-9960, is also available for use as a blocking control in assays to test for specificity of this PEF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PEF1

Target: PEF1 (Penta-EF-Hand Domain Containing 1 (PEF1))

Alternative Name: PEF1 (PEF1 Products)

Synonyms: 2600002E23Rik antibody, Peflin antibody, ABP32 antibody, PEF1A antibody, zgc:100787 antibody, penta-EF hand domain containing 1 antibody, penta-EF-hand domain containing 1 antibody, penta-EF-hand domain containing 1 L homeolog antibody, Pef1 antibody, PEF1 antibody, pef1 antibody, pef1.L antibody

Background: PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit, sorcin, grancalcin, and ALG2.PEF1 is a Ca(2+)-binding protein that belongs to the penta-EF-hand (PEF) protein family, which includes the calpain small subunit.

Molecular Weight: 31 kDa (MW of target protein)