HSPA1L antibody (C-Term)

Catalog No. ABIN633004

Product Details anti-HSPA1L Antibody

Target: HSPA1L (Heat Shock 70kDa Protein 1-Like (HSPA1L))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPA1L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HSPA1 L antibody was raised against the C terminal of HSPA1

Purification: Affinity purified

Immunogen: HSPA1 L antibody was raised using the C terminal of HSPA1 corresponding to a region with amino acids DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPA1L Blocking Peptide, catalog no. 33R-1900, is also available for use as a blocking control in assays to test for specificity of this HSPA1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSPA1L

Target: HSPA1L (Heat Shock 70kDa Protein 1-Like (HSPA1L))

Alternative Name: HSPA1L (HSPA1L Products)

Synonyms: Hsc70t antibody, Msh5 antibody, HSPA1L antibody, hspa1l antibody, MGC147483 antibody, Hsp70-3 antibody, HSP70-1L antibody, HSP70-HOM antibody, HSP70T antibody, hum70t antibody, heat shock 70kDa protein 1-like antibody, heat shock protein 1-like antibody, heat shock 70 kDa protein 1-like antibody, heat shock protein family A (Hsp70) member 1 like antibody, HSPA1L antibody, Hspa1l antibody, LOC471967 antibody, hspa1l antibody, LOC474850 antibody, LOC102177850 antibody, LOC100050904 antibody

Background: HSPA1L is a 70 kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles.

Molecular Weight: 70 kDa (MW of target protein)